SECRET tries to answer the following questions:

"What is the chance that my soluble protein will crystallize?"

"Which of my soluble proteins have the best/worst chances to crystallize?"

The prediction is based on a classifier trained with the dataset SMALL. For more details read the short method description and/or reference.

The classifier will give sensible results only if provided with sequences of soluble proteins.

The input protein sequences are categorized into two classes: YES - crystallizable; NO - non-crystallizable. Additionally the probability of a class (from 0.5 to 1.0) is provided. The probability threshold value is set by default to 0.5. By increasing it one can expect higher classification precision (selectivity) and lower recall (sensitivity). If the result cannot be calculated, a comment is written.

If you use this server, please cite:
Smialowski P, Schmidt T, Cox J, Kirschner A, Frishman D. Will my protein crystallize? A sequence-based predictor. Proteins. 2006 Feb 1;62(2):343-55.

Submit your sequence:

Input sequences

Please provide upto 25 unambiguous protein sequences (only 20 amino acids symbols are allowed) of length between 46-200 amino acids in multiple FASTA format

_

Fasta protein sequence

>sample MAHHHHHHVDDDDKMAATAAAVVAEEDTELRDLLVQT LENSGVLNRIKAELRAAVFLALEEQEKVENIEGRKTPLVN ESLMKFLNTKDGRLVASLVAEFLQFFNLDFTLAVFQPET STLQGLEGRENLARDLGIIEAEGTVGGPLLLEVIRRW_

Sample of input sequence

Calculation in progress ...